PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN09989.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 308aa    MW: 33470.8 Da    PI: 10.0776
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN09989.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.5e-372280260
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                +++++kcprCds+ntkfCy+nnyslsqPr+fCkaC+ryWt GG++rn+PvGgg+rk k+
  KHN09989.1 22 PQQHQKCPRCDSMNTKFCYFNNYSLSQPRHFCKACKRYWTLGGTFRNIPVGGGSRKVKR 80
                68899***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.2E-322480IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.9222680IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-182770IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEQEGEKGRE EKRQIQQQQP PPQQHQKCPR CDSMNTKFCY FNNYSLSQPR HFCKACKRYW  60
TLGGTFRNIP VGGGSRKVKR GKTNSPSSSS SSSSCSNLLS QPQQNLLMRP SPPPLTTNTM  120
VQSTSPYYYN LGVGGNGYLS FHSSLNNNTP SQPSDQYLKV GGGDHVAGSS NISPLVSGFN  180
NAASYSLPPR FHHQQQQQSM HSAQQQQQRL INIPSNMASS SSDVSHSGVR PQSLINNVST  240
STDHNVSTST NHRAITTSDA SLWSAATINA TSIGGNSDQN NVVKGSSSSS SSLVPNLWLH  300
RPGFGPPQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572590.0DQ857259.1 Glycine max Dof9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236600.10.0Dof9
TrEMBLA0A0B2PQL30.0A0A0B2PQL3_GLYSO; Dof zinc finger protein DOF1.7
STRINGGLYMA13G24611.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3613022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.13e-24Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]